SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015859 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015859
Domain Number 1 Region: 14-73,108-226
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.12e-41
Family YicI catalytic domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015859   Gene: ENSTGUG00000015524   Transcript: ENSTGUT00000016139
Sequence length 226
Comment pep:novel chromosome:taeGut3.2.4:Un:156283929:156292363:1 gene:ENSTGUG00000015524 transcript:ENSTGUT00000016139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTYRPYELGQEMGVWVNNSDGVTPALGQIWPPGYSVFPDFTNPRTVEWWTTLCLEFKDV
LDYDGIWIDMNEPANFMRGQLPGCADTEINNPPYTPSITDRSLAEKTLCPDSKTYLGDHY
NTHSLFGWSQTEPTFNVVQQATGKRAFVLARSTFVGSGKHGGHWLGDNFSLWKDLHHSII
GILEFNLFGIPYVGADICGFNYNTTYELCLRWMQLGSFYPFSRNHN
Download sequence
Identical sequences H0ZZ06
ENSTGUP00000015859 59729.ENSTGUP00000015859 ENSTGUP00000015859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]