SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015904 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015904
Domain Number 1 Region: 138-218
Classification Level Classification E-value
Superfamily Homeodomain-like 2.31e-26
Family Homeodomain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015904   Gene: ENSTGUG00000015572   Transcript: ENSTGUT00000016192
Sequence length 253
Comment pep:known_by_projection chromosome:taeGut3.2.4:15_random:210110:216562:1 gene:ENSTGUG00000015572 transcript:ENSTGUT00000016192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFVNPLFSKYKGGESLEPTYYDCRFPQSVGRSPAAVLYGPGGAAPSFQHPSHHVQEF
FHHGASGISSPSGYQQNAPCALACHGDASKFYGYEALPRQALYGAQQDAPAVPYADCKSS
AGGGGGGGGGGAEGQGGHLSQSSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLF
NPYLTRKRRIEVSHALGLSERQVKIWFQNRRMKWKKENNKDKLPGAARDEEKGEEEGHEE
EEKEEEEKEESKD
Download sequence
Identical sequences H0ZZ51
ENSTGUP00000015904 ENSTGUP00000015904 59729.ENSTGUP00000015904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]