SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015920 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015920
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Cupredoxins 8.32e-36
Family Multidomain cupredoxins 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015920   Gene: ENSTGUG00000015588   Transcript: ENSTGUT00000016208
Sequence length 112
Comment pep:novel chromosome:taeGut3.2.4:Un:128703964:128705368:1 gene:ENSTGUG00000015588 transcript:ENSTGUT00000016208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLGPTLHAEVGDTLVVHLKNMADKPVSIHPQGLVYSKNEEGSLYDDRTSSAEKRDDAVL
PGQLYTYVWDISEEVGPGEADLPCLTYAYYSHENMAMDFNSGLIGALLICKK
Download sequence
Identical sequences H0ZZ67
ENSTGUP00000015920 59729.ENSTGUP00000015920 ENSTGUP00000015920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]