SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015959 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000015959
Domain Number - Region: 156-187
Classification Level Classification E-value
Superfamily UBA-like 0.0344
Family CUE domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015959   Gene: ENSTGUG00000015631   Transcript: ENSTGUT00000016250
Sequence length 188
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:44535143:44536596:-1 gene:ENSTGUG00000015631 transcript:ENSTGUT00000016250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKL
GLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKF
KVQGEPVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNS
NDIVNAIM
Download sequence
Identical sequences A0A091ED26 A0A091MXJ0 A0A093DE02 A0A093Q1K3 H0ZZA6
ENSTGUP00000015959 59729.ENSTGUP00000015959 ENSTGUP00000015959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]