SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016008 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016008
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-55
Family SPRY domain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016008   Gene: ENSTGUG00000015683   Transcript: ENSTGUT00000016302
Sequence length 159
Comment pep:novel chromosome:taeGut3.2.4:16_random:164291:164767:1 gene:ENSTGUG00000015683 transcript:ENSTGUT00000016302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSLDPDTANPYLVLSEDKRSVRLRGAPQELPAHPKRFDFAFCILTSEGFSAGRHYWEVE
VGDGESWVLGAARESVRRKEKVDFAPEEGIWAVGLNWKGKNWDQYQAFTSPETPLSLCER
PRKIGVYLDYEGGWVAFYNADSMAPIFTFTAAFSERIFP
Download sequence
Identical sequences H0ZZF4
ENSTGUP00000016008 59729.ENSTGUP00000016008 ENSTGUP00000016008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]