SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016031 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016031
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-28
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016031   Gene: ENSTGUG00000015709   Transcript: ENSTGUT00000016328
Sequence length 112
Comment pep:novel chromosome:taeGut3.2.4:17_random:81013:83318:1 gene:ENSTGUG00000015709 transcript:ENSTGUT00000016328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AICRYPLGMHEGTIRDEDITASSQWYDSTGPQYARLQREEGDGAWCPAGLLEPEDVQFLQ
IDLHKLFFITLVGTQGRHARATGKEFARAYRIDYSRNGERWISWRSRQGGRV
Download sequence
Identical sequences H0ZZH7
ENSTGUP00000016031 59729.ENSTGUP00000016031 ENSTGUP00000016031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]