SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016038 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016038
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-67
Family Eukaryotic proteases 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016038   Gene: ENSTGUG00000015682   Transcript: ENSTGUT00000016335
Sequence length 233
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:129216687:129218315:-1 gene:ENSTGUG00000015682 transcript:ENSTGUT00000016335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVVGGTEARSHAWPYQISLQYYSSGSWHHTCGGSLIQRNWVMTAAHCVNKQLQYRVVAGE
HNLNVNDGTEQVFSVSKIVVHPYWNSNNVGAGYDIALFRLSTSATLNSVVQLAVLPQQGI
VLPNLPLRHHLLGPFPELLNASLPVVDYQISSSASYWGSLVKNTMVCAGGDGVRSGCQGD
SGGPLHCAVNGQYQVHGVTSFVSSQGCNVARKPTVFTRVSAYVSWINSVIAQN
Download sequence
Identical sequences H0ZZI4
ENSTGUP00000016038 ENSTGUP00000016038 59729.ENSTGUP00000016038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]