SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016048 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000016048
Domain Number - Region: 122-143
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0302
Family Chromo domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016048   Gene: ENSTGUG00000015727   Transcript: ENSTGUT00000016346
Sequence length 145
Comment pep:known_by_projection chromosome:taeGut3.2.4:17_random:140442:141241:-1 gene:ENSTGUG00000015727 transcript:ENSTGUT00000016346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSLKSTSSGQTFLSDLDSTDATSTSGSATTSLSHESSRRTVGSRKRKLAVPAYTSGAKR
RGAELGGCPSATTPEGSPDGGIDSHTFESISEDDSSLSHLKSSISSYFGAAGRLVCGERY
QVLARRVTLEGKVQYLVEWEGTTPY
Download sequence
Identical sequences H0ZZJ4
59729.ENSTGUP00000016048 ENSTGUP00000016048 ENSTGUP00000016048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]