SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016065 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016065
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.78e-40
Family APC10-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016065   Gene: ENSTGUG00000015735   Transcript: ENSTGUT00000016363
Sequence length 232
Comment pep:novel chromosome:taeGut3.2.4:Un:74185695:74188291:-1 gene:ENSTGUG00000015735 transcript:ENSTGUT00000016363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVPPTWTYECDEDLVHFLYDHIGKEDENLGSVKQYVDSIDVSSYTEDFNVSCLTDSHADT
YWESDGSQGQHWVRLNMKKGTIVKKLLLTVDTTDENFMPKRVAVYGGEGDNLKKLNDVGI
DESYIGDVCILEDMTTHLPVIEIRIVECRDDGIDVRIRGIKIKSSRQRDLGLSADMFQLP
NLVRYPRLEGTDPDLLYRRAVLIQRFIKLLDSVLHHLVPAWDHTVGTFSKLK
Download sequence
Identical sequences H0ZZL1
XP_012431531.1.42559 59729.ENSTGUP00000016065 ENSTGUP00000016065 ENSTGUP00000016065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]