SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016136 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016136
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000942
Family YVTN repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016136   Gene: ENSTGUG00000015815   Transcript: ENSTGUT00000016435
Sequence length 189
Comment pep:novel chromosome:taeGut3.2.4:Un:105996660:105998492:-1 gene:ENSTGUG00000015815 transcript:ENSTGUT00000016435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVWNVETHQCIERMKHEKKYSICGLAWHPKYKQIAYTDNEGNLGLLENIGDVEKPNDKV
ASAVAKDYNDLFDGDDDDYLNGDMIEPPPSPKTGDNEDDADDLMQPPGHMRRALIDDDDD
DNSLDIGLIKASSGLLEKEDDGDDQPGGFSALPPSSTQQPFYDGPMPTPRQKPFQSASTP
VHLMHRFMV
Download sequence
Identical sequences H0ZZT2
ENSTGUP00000016136 59729.ENSTGUP00000016136 ENSTGUP00000016136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]