SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016176 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016176
Domain Number 1 Region: 1200-1465
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-51
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 3698-3974
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-46
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 3 Region: 1515-1772
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-45
Family YWTD domain 0.0000183
Further Details:      
 
Domain Number 4 Region: 1821-2046
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-44
Family YWTD domain 0.0000128
Further Details:      
 
Domain Number 5 Region: 472-709
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-40
Family YWTD domain 0.0000129
Further Details:      
 
Domain Number 6 Region: 137-407
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000986
Further Details:      
 
Domain Number 7 Region: 2130-2394
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-36
Family YWTD domain 0.0000338
Further Details:      
 
Domain Number 8 Region: 2997-3128
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-27
Family YWTD domain 0.000052
Further Details:      
 
Domain Number 9 Region: 3575-3584,3631-3690,3966-4030
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 10 Region: 1116-1194,1459-1509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000196
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 11 Region: 779-819
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 12 Region: 945-983
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 13 Region: 3438-3474
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 14 Region: 3480-3525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 15 Region: 820-862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 16 Region: 861-899
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 17 Region: 905-942
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 18 Region: 3209-3249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 2620-2656
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 988-1028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 21 Region: 2663-2698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 2830-2871
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 2702-2737
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2485-2526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 79-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000907
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 26 Region: 3252-3289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 3172-3207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 1775-1825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000971
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 1074-1109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 30 Region: 2449-2487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 31 Region: 2582-2614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 32 Region: 2780-2819
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 7-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 34 Region: 2083-2132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000435
Family EGF-type module 0.018
Further Details:      
 
Domain Number 35 Region: 1037-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 3134-3189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family EGF-type module 0.015
Further Details:      
 
Domain Number 37 Region: 2958-2995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000311
Family EGF-type module 0.028
Further Details:      
 
Domain Number 38 Region: 3410-3436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 734-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000124
Family EGF-type module 0.016
Further Details:      
 
Domain Number 40 Region: 3522-3558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000353
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 41 Region: 2756-2777
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000563
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016176
Domain Number - Region: 4027-4061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000101
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 4097-4132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 422-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000394
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4074-4095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00718
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 4137-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00761
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2525-2553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00851
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number - Region: 53-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0173
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2405-2464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016176   Gene: ENSTGUG00000015747   Transcript: ENSTGUT00000016479
Sequence length 4326
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:44592872:44646955:1 gene:ENSTGUG00000015747 transcript:ENSTGUT00000016479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQSKVSRCQPNEHNCLGTELCIHMSKLCNGLHDCFDGSDEGPHCREQLANCSALGCQHHC
APTLSGPVCYCNHSFQLAEDRRSCRDFDECTVYGTCSQTCTNTEGSYTCSCVEGYLLQPD
NRSCKAKNEPVDRPPVLLIANSQNILATYLSGAPVPNITPTSAKQTTAMDFNYVEDTVCW
VHVGDSASQTILKCAKIPNLKGFVEERSINISLSLHHVEQMAIDWLTGNFYFVDDIDDRI
FVCNKNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDS
KIVFPHGITLDLVNRLVYWADAYLDYIEVVDYEGKNRHTIIQGILIEHLYGLTVFENYLY
ATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPTVRSHACEPDQFG
KPGGCSDICLLGNSHKSRTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMG
AKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNV
EGIAVDWMGNNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYW
TDWEEDPKDSKRGKIERAWMDGSNRNIFITSKTVLWPNGLSLDIPAKILYWVDAFYDRIE
MVYLNGTERKASEGPELNHAFGLCHYSNFLFWTEYRSGSIYRLDQASKAVSLLRNERPPI
FEIRMYDAQQQQVGSNKCRVNNGGCSSLCLATPRGRQCACAEDQMLGEDSVTCQANPSYI
PPPQCQPGEFACKNNRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPSDRFKCKNNRCIP
NRWLCDGDNDCGNNEDESNSTCSARTCSPNQFSCASGRCIPISWTCDLDDDCGDRSDESA
SCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSNQFKCNSGRCIP
VHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPMRWRCDGDTDCM
DSSDEKNCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLVCKPPS
HTCANNTSICLPPEKLCDGSDDCGDGSDEGELCDQCSLNNGGCSHNCTVAPGEGIVCSCP
LGMELGADNKTCQIQSYCAKHLKCSQKCEQDKYNVKCSCYEGWMLEPDGESCRSLDPFKP
FIIFSNRHEIRRIDLHRGDYSVLVPGLRNTIALDFHLNQSSLYWTDVVEDKIYRGKLLEN
GALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLLAGDIEHP
RAIALDPRYGILFWTDWDASLPRIEAASMSGEGRRTIHKETGSGGWPNGLTVDYLEKRIL
WIDARSDAIYSALYDGTGHIEVLRGHEYLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTG
HNVTVVQRTNTQPFDLQVYHPSRQPLAPNPCEANGGKGPCSHLCLINYNRTLSCACPHLM
KLDKDNTTCYEFKKFLLYARQMEIRGVDIDNPYYNYIISFTVPDIDNVTVVDYDALEQRI
YWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLSVDWVSRNLFWTSYDANKKQINVARL
DGSFKNAVIQGLDKPHCLVVHPLRGKLYWTDGDNISVANMDGSNRTLLFTNQKGPVGLAI
DYPESKLYWISSGNGTINRCDLDGGNLEVMESVRSQLSKATALAIMGDKLWWADQASERM
GTCNKKDGTEVTVLRNSTTLVMHMKVYDESIQQAGTNPCSQNNGDCSQLCLPTSETSRSC
MCTAGYSLKSGQQSCEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHA
ENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEV
ARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTERMVLVNVSI
SWPNGISVDYEDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEEYIYWS
DRTHANGSIKRNKDNATESVSLRTGIGVQLKDIKVFNRARQKGTNICAQNNGGCQQLCLF
RGGGQRTCACAHGMLSEDGVSCRDYDGYLLYSERTILKSIHLSDENNLNAPIKPFEDAEH
MKNVIALAFDYRYGSKGSNRIFYSDIHFGNIQQINDDGTGRKTIVENVGSVEGLAYHRGW
DTLYWTSYTTSTITRHTVDQSRVGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQ
HPSIMRATLSGANVLIIIDQDIRTPNGLAIDHKAEKIYFSDATLDKIERCEYDGSHRHVI
LKSEPVHPFGLAVYGDYIFWTDWVRRAVQRANKYVGTDMKLLRVDIPQQPMGIIAVANDT
DSCELSLCQVNNGGCQDLCLLTPKGHVNCSCRGERVLQEDFTCKAVNSTCNVHEEFECGN
GECIDFSRTCDGVVHCKDKSDEKQSYCSSRKCKKGYLHCMNGRCVASRYWCDGVDNCGDN
SDEVPCNKTSCAATEFRCRDGTCIGNSSRCNHRAGAARARPGGSCPATDCSSYFRLGVKG
TTFQKCEHTSLCYAPSWVCDGANDCGDYSDERNCPGGRKPKCPSNYFACPSGRCIPMTWT
CDKEDDCENGEDEMQCSERQDKFCYPVQFECNNHRCISKLWVCDGADDCGDGSDEDSRCR
LTTCSSGSFQCPGTYVCVPERWLCDGDKDCADGADETLAAGCCGGLGRPGLAGLTVCIPK
HFVCDHDDDCGDGSDESPECEYPTCGPHEFRCQNGRCLSNRQGECDGEFDCHDHSDEAPK
NTRCSSPENKCNDSFFLCKNGNCISEALLCDNNNDCADGSDELNCFINECLNKKLSGCSQ
ECEDLKIGYKRGPRDVRVVSVLCQLGQGRDTGASGTVCASQLSLLSLRVPWWHLSPPSTC
HLPARALEVSDSSGLLLQCRCRPGFRLKDDGKTCIDIDECSTTYPCSQKCINTLGSYNYL
YWTDWGDHSLIGKIGMDGTNRSVIVDTKITWPNGLTLDYINSRIYWADAREDYIEFASLD
GSNRHTVLSQDIPHIFALTLFEDFIYWTDWETKSINRAHKTTGANKTLLISTLHRPMDIH
IYHPYRQPDVPNHPCKTNNGGCSNLCLLSPGGGHKCACPTNFYLGSDGKTCVSNCTASQF
VCKNDKCIPFWWKCDTEDDCGDRSDEPEDCPEFKCRPGQFQCSTGICTNPAFICDGDNDC
QDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDEKDCRAQVCILGCLA
PWVTPRLSPYPWFLQTLCPLKSLSPLKWIWAEPLAQLRDLVASCAPIAWSLLGPFYGSAP
SPPPSTPAPVIPGASTHLSTPRLLFGERAGWAHAVFFPSARPAPRASLVCHGRCIAGRWK
CDGDHDCADGSDEKDCTPRCEFDQFKCKNGHCIPMRWRCDADADCMDGSDEENCGTGVRT
CPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECLKFQCPPNRPFRCKNDRVCLWIG
RQCDGIDNCGDNTDEKDCESPTAKPKSCSQDKNEFLCGNKKCISANLRCNFFDDCGDGSD
EESCSHEHKSYDCMTNSTMCGDEAHCVQSQSTSYCTCRRGFQKVPDKNFCQDINECLRFG
TCSQLCNNTKGSHVCSCAKNFMKTDNMCKAEGSEHQILYIADDNKIRSMYPFNPNSAYEP
AFQGDENVRIDAMDIYVKGNKIYWTNWHTGRISYRELPTSSSASTASNRNRRQIDGGVTH
LNISGLKMPRGIAIDWVAGNIYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPL
RGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGS
IRLNGTDPVVAIDNKRGLSHPFSIDIFEDYIYGVTYINNRIFKIHKFGHKPVTNLTSGLN
HATDVVLYHQYKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVVVPSPTVS
PCPPTTRVDLVCLNGGSCFLNARKQDKCRCQPRYNGDKCQIDQRTDRRTGGRGRVSSLGM
PTCRCPTGFTGPRCNQQVCTDYCQHNGSCTVNQGNQPSCRCPPTFIGDRCQYRQCFDYCE
NDGVCQMTASGAKQCRCPPQFEGAQCQENKCSRCQEGKCSINKQSGEVSCCRCWGCRAGG
RKWGTASIVIPILLLLILLTVVAFVWYKWRIKGAKGFQHQRMTNGAMNVEIGNPTYKMYE
GEPDDDVGELLDADFALDPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKRELLARGDDD
LADPLA
Download sequence
Identical sequences H0ZZX2
ENSTGUP00000016176 ENSTGUP00000016176 59729.ENSTGUP00000016176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]