SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016224 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016224
Domain Number 1 Region: 117-177
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000606
Family YhhF-like 0.046
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016224
Domain Number - Region: 90-128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0989
Family Galectin (animal S-lectin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016224   Gene: ENSTGUG00000015904   Transcript: ENSTGUT00000016532
Sequence length 213
Comment pep:novel chromosome:taeGut3.2.4:Un:18472245:18475608:1 gene:ENSTGUG00000015904 transcript:ENSTGUT00000016532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMDDDDDIPQLSSHTLAALQEFYLEQQQREGMKTSQGFNQYSIGSIEENWQLSQFWYSDE
TASCLAKEAVLAAGKGGRIACISAPSVYQKLKEQDGEDFSVCILEYDRRFSVYGEEFIFY
DYNHPLDLPENLLPHSFDIVIADPPYLSEECLQKTAETIKYLTKGKILLCTGAVMEEEAA
KQLGVKMCKFIPKHSRNLANEFRCYVNYASGLD
Download sequence
Identical sequences H1A020
ENSTGUP00000016224 59729.ENSTGUP00000016224 ENSTGUP00000016224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]