SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016281 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016281
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.71e-25
Family Eukaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016281   Gene: ENSTGUG00000015967   Transcript: ENSTGUT00000016594
Sequence length 97
Comment pep:novel chromosome:taeGut3.2.4:1A_random:89409:90070:1 gene:ENSTGUG00000015967 transcript:ENSTGUT00000016594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHADNLCAGYPQGGIDTCQGDSGGPLVCKDNRADYFWLVGLNSWGRGCDRARHPAIYTST
QHFYNWILLQTGLSPAERAGPAPKPVITSAPEEEPEE
Download sequence
Identical sequences H1A074
59729.ENSTGUP00000016281 ENSTGUP00000016281 ENSTGUP00000016281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]