SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016333 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016333
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000485
Family Ovomucoid domain III-like 0.00096
Further Details:      
 
Domain Number 2 Region: 136-185
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000707
Family Ovomucoid domain III-like 0.00033
Further Details:      
 
Domain Number 3 Region: 65-114
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000136
Family Ovomucoid domain III-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016333   Gene: ENSTGUG00000016012   Transcript: ENSTGUT00000016649
Sequence length 185
Comment pep:novel chromosome:taeGut3.2.4:Un:160478388:160481697:-1 gene:ENSTGUG00000016012 transcript:ENSTGUT00000016649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVDCSTYPNTTNEEGREVLVCSTAVSSICGSDGVTYGNECQLCAYNAEYGTNVSKDHDGE
CKEVAPVDCSRYPNTTSEEGKVVLLCNKDISPVCGTDWVTYENECLLCARNLTENGFCGQ
PNGPSSPWQLGAGAVDCSEYPKPVCSLAYMPLCGSDNTTYSNKCAFCNAVMDSNGTITLN
HFGKC
Download sequence
Identical sequences H1A0C5
ENSTGUP00000016336 ENSTGUP00000016333 59729.ENSTGUP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]