SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016336 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016336
Domain Number 1 Region: 132-184
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000277
Family Ovomucoid domain III-like 0.0003
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000499
Family Ovomucoid domain III-like 0.00096
Further Details:      
 
Domain Number 3 Region: 65-115
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000319
Family Ovomucoid domain III-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016336   Gene: ENSTGUG00000016012   Transcript: ENSTGUT00000016652
Sequence length 184
Comment pep:novel chromosome:taeGut3.2.4:Un:160478388:160481697:-1 gene:ENSTGUG00000016012 transcript:ENSTGUT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVDCSTYPNTTNEEGREVLVCSTAVSSICGSDGVTYGNECQLCAYNAEYGTNVSKDHDGE
CKEVAPVDCSRYPNTTSEEGKVVLLCNKDISPVCGTDWVTYENECLLCARNLNQGLALLE
LLFDSRTSSKAFSVDCSEYPKPVCSLAYMPLCGSDNTTYSNKCAFCNAVMDSNGTITLNH
FGKC
Download sequence
Identical sequences H1A0C8
ENSTGUP00000016336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]