SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016347 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016347
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-33
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016347   Gene: ENSTGUG00000016022   Transcript: ENSTGUT00000016663
Sequence length 115
Comment pep:novel chromosome:taeGut3.2.4:Un:108240350:108240968:-1 gene:ENSTGUG00000016022 transcript:ENSTGUT00000016663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAVCLIVLLGYAYGCGQPAVPPQLSSRVVGGEDAVAHSWPWQISLQTRRSGSWSHYCG
GTLIAPQWVLTAAHCISSSMTYRVALGRQDLSETDEPGSVAVAVEKIIVHEDWDS
Download sequence
Identical sequences H1A0D9
ENSTGUP00000016347 ENSTGUP00000016347 59729.ENSTGUP00000016347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]