SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016357 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016357
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-23
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 120-202
Classification Level Classification E-value
Superfamily GFP-like 0.00000000000000282
Family Domain G2 of nidogen-1 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016357
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000599
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016357   Gene: ENSTGUG00000016039   Transcript: ENSTGUT00000016674
Sequence length 203
Comment pep:novel chromosome:taeGut3.2.4:Un:131909844:131911404:-1 gene:ENSTGUG00000016039 transcript:ENSTGUT00000016674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDVGQYRCVAENDVGTAAKVVTLVLQSAPVVTVTPAELRVHAGQPVLLHCVVSGEPTPSV
EWQRDGEPLPEGPHARVLPNATLLLPSVAHRDAGSYSCLARSALGSAAAHASLDVRGELR
QVRGSLVGAINGHQLGVSTLDATVLGDSPSSTATLRSTIGSIPPAIGPLMRVLVTIIAPV
YWSLAHASGAAQNGLLLTQGTFQ
Download sequence
Identical sequences H1A0E9
ENSTGUP00000016357 59729.ENSTGUP00000016357 ENSTGUP00000016357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]