SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016358 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000016358
Domain Number - Region: 1-25
Classification Level Classification E-value
Superfamily UBA-like 0.0316
Family CUE domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016358   Gene: ENSTGUG00000016036   Transcript: ENSTGUT00000016675
Sequence length 140
Comment pep:novel chromosome:taeGut3.2.4:Un:18842577:18846995:-1 gene:ENSTGUG00000016036 transcript:ENSTGUT00000016675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQVINNILEEKLVPYLDKLDRRMQRQLKPDPTPLVQLLAVTFQIDDKPIASKAGFDPCLF
FPLPGRREKDTTRSLVNDKRLVAEQRQRYSQYSVVLEELPLQPGAAQPFEDYEDEYDDTY
DGNQVGANDADSDDELISRR
Download sequence
Identical sequences H1A0F0
ENSTGUP00000016358 ENSTGUP00000016358 59729.ENSTGUP00000016358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]