SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016376 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016376
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-68
Family Eukaryotic proteases 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016376   Gene: ENSTGUG00000016050   Transcript: ENSTGUT00000016694
Sequence length 238
Comment pep:novel chromosome:taeGut3.2.4:1A_random:173972:177236:-1 gene:ENSTGUG00000016050 transcript:ENSTGUT00000016694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVVAGTGVQPGAWPGIVSIQATWENGTWHMCSGVLLSSQWVLTVAHCFARAGGISMWEV
VIGASDLSQPGPEAAVRHIQRLLVHQHYVPATARNDIALMELDRPVECSDYIQLGCVPDA
SIRVSELKSCYIAGWNFVRGELPTGCMVLQESKVHLMDTELCNSSPWYAGAVHADNLCAG
YPQGSIDTCQGDSGGPLVCKDNRADYYWLVGLNSWGRGCDRARHPAIYTSTQHFYNWI
Download sequence
Identical sequences H1A0G7
59729.ENSTGUP00000016376 ENSTGUP00000016376 ENSTGUP00000016376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]