SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016395 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000016395
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000145
Family DIX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016395   Gene: ENSTGUG00000016079   Transcript: ENSTGUT00000016716
Sequence length 95
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:45560826:45566519:1 gene:ENSTGUG00000016079 transcript:ENSTGUT00000016716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKEEISDDNAKLPCFNGRVVSWLVLAESSHSDTGSQCTESHAELPPALERTGGIGDSRP
PSFHPNAASSRDGLDNETGTESVVSHRRERHRRRN
Download sequence
Identical sequences H1A0I6
ENSTGUP00000016395 59729.ENSTGUP00000016395 ENSTGUP00000016395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]