SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016477 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016477
Domain Number 1 Region: 14-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016477   Gene: ENSTGUG00000016163   Transcript: ENSTGUT00000016803
Sequence length 44
Comment pep:novel chromosome:taeGut3.2.4:Un:133392408:133392539:-1 gene:ENSTGUG00000016163 transcript:ENSTGUT00000016803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFPAAPVAAAVRSHFHECPDSHRQFCFHGTCRFLVQEEKPACV
Download sequence
Identical sequences H1A0R8
ENSTGUP00000016477 ENSTGUP00000016477 59729.ENSTGUP00000016477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]