SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016490 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016490
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000143
Family Prokaryotic proteases 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016490   Gene: ENSTGUG00000016179   Transcript: ENSTGUT00000016819
Sequence length 56
Comment pep:novel chromosome:taeGut3.2.4:Un:133733636:133734020:1 gene:ENSTGUG00000016179 transcript:ENSTGUT00000016819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAVTKKKYIGIRMMSLT
Download sequence
Identical sequences H1A0T0
ENSTGUP00000016490 59729.ENSTGUP00000016490 ENSTGUP00000016490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]