SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016492 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016492
Domain Number 1 Region: 170-414,470-554
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.49e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000144
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016492
Domain Number - Region: 689-751
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000104
Family Ubiquitin-related 0.032
Further Details:      
 
Domain Number - Region: 1037-1103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0219
Family Ubiquitin-related 0.02
Further Details:      
 
Domain Number - Region: 1230-1260
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0871
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016492   Gene: ENSTGUG00000016131   Transcript: ENSTGUT00000016821
Sequence length 1364
Comment pep:known chromosome:taeGut3.2.4:5_random:1648562:1693585:-1 gene:ENSTGUG00000016131 transcript:ENSTGUT00000016821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMFWSCRQSIFAEMKKKFSQAECAAEEPRVLCIIQDTTNSKTVNERVTLNLPASTPLKRL
FEDVAAKVGYVNGSFDLLWSNGDSVTDTTPIDQNSDKTILDAGFEPGKKNFLHLTDKDGE
QPHVMQEESGTTEDGAQERFIGPLPREGSIGCTHDYVSQNYSYSSVLSKSETGYVGLVNQ
AMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPERSIPYQLQRLFVLLQTSKKRAIET
TDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLE
CGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDA
RKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSVFIDVEDEKSPQTES
CTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLESNSAAERISKTGSEKSSLLYELFSVM
VHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSKITQEDIKKTYGGSSGSRGYYSSAFASS
TNAYMLIYRLKDPTRNAKFLEAHEYPEHIKQLVQKERELEEQEKRQREIERNTCKIKLFC
MHPTKQIMMENKLEVHKDRTLKEAVEMAYKLMDLEEAVPLNCCRLVKYDEFHDYLERSYE
GEEDTPMGLLLGGVKSTYMFDLLLETRRPDQIFQCYKPGEVMVKVHVVDLKTESVAPPIS
VRAYLNQTVSEFKQLISKATHLPPETMRVVLERCYNDLRLLNMSSKTLKAEGFFRSNKVF
VESSESLDRHVTYTDSQLWKLLDRHANTIRLYVSLPEQAPGSQLRRALYHKSGGGAGNVD
EPCERVKGPVGNMKSVEAILEESTEKLKSLSLQQQQQQEGDNGDSSKSTEASDFENIESP
LNEIDSSASAENRELDNQIQVSDPENLQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTL
CNVDNAPLPLANGLDSHSITSSRRSKANQGKKETWDTAEEDSGTDSEYDESGKSRGEAQY
MYFKSEPYTTEEGSGEGQKWLMVHVDKRITLSAFKQHLEPFVGVPSSHFKVFRVYASNQE
FESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEPEPCKFLLDAVFAKGMT
VRQSKEELLPQLQEQCGLDLTIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLE
ILDGVEKMKSMSQLAVLSRRWRPSEMKLDSFQEVVLESSSVEELKEKLSEISGIPLENIE
FAKGRGTFPCDISILEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQ
RNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences H1A0T2
59729.ENSTGUP00000016492 ENSTGUP00000016492 ENSTGUP00000016492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]