SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016494 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016494
Domain Number 1 Region: 108-165
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000034
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ras GEF 0.00000222
Family Ras GEF 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016494   Gene: ENSTGUG00000016180   Transcript: ENSTGUT00000016823
Sequence length 165
Comment pep:novel chromosome:taeGut3.2.4:Un:162128943:162132470:-1 gene:ENSTGUG00000016180 transcript:ENSTGUT00000016823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAALYGDLLQEDEAAMAFLEEFYVSVSDDT
RMIAALKEQLPELEKIVKQISEEPKAPQKKHKVLLQLFNTSDDRAQKRQPIRGSDEVLFK
VYCIDQTYTTIRVPVSSSVKEVISAVADKLGSGEGLIIVKMSSGG
Download sequence
Identical sequences H1A0T4
ENSTGUP00000016494 59729.ENSTGUP00000016494 ENSTGUP00000016494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]