SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016531 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016531
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Cupredoxins 1.82e-35
Family Ephrin ectodomain 0.0000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016531   Gene: ENSTGUG00000016221   Transcript: ENSTGUT00000016864
Sequence length 105
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:110481485:110481887:-1 gene:ENSTGUG00000016221 transcript:ENSTGUT00000016864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYLDIICPHYEESVDPRGRERYTLYLVELEVYQACKPRSKEQIRWECNKPSALHGPEKFS
EKFQRFTPFTLGKEFREGHSYYYISKPIHHHGEACLKLKVTVTGK
Download sequence
Identical sequences H1A0X0
59729.ENSTGUP00000016531 ENSTGUP00000016531 ENSTGUP00000016531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]