SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016549 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016549
Domain Number 1 Region: 396-453
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.07e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016549   Gene: ENSTGUG00000016240   Transcript: ENSTGUT00000016885
Sequence length 453
Comment pep:novel chromosome:taeGut3.2.4:5_random:2116879:2121481:1 gene:ENSTGUG00000016240 transcript:ENSTGUT00000016885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTDYGCDIEKGSVCTYHPGAVHCVRGIQASPKYGAGQQCCYGSTGTQILTHDSTGGSTP
DRGHDWGSPPFLKPPRIPGFSHWLYDVISFYYCCLWSDNCDFYMKRRPSSDCRTYRPPRA
ASAFGDPHFLTFDASFGGFNVYGFYVLFHLWRAALTRSCRSRDAGRKKNGRDIERAWRRS
HIREMEKERKIVTPGSGASSSQPLSDGGKAIFCPLPLIVAGLFLYSTPDQNITVMFSSGS
GVEIRGSGGFLTLTILLPEKFMNHTWGLFGVMNGNPEDDYTFKNKTTMSVHASPQQVFEF
GASWAIKNGTSLFTYDTEFLLDSFFYGDKHNASFLPVFSPHEDPADPLLEEMASRCGSDP
FCRFDVLTTRSLQVGSSTRLSHQNHKLLVEHLEPVISCGWLDHPTNGRKNATNYLLGSVI
NFTCNEGYELTGSQERTCQASGAWSGDTPQCSP
Download sequence
Identical sequences H1A0Y8
59729.ENSTGUP00000016549 ENSTGUP00000016549 ENSTGUP00000016549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]