SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016565 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016565
Domain Number 1 Region: 63-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-84
Family Eukaryotic proteases 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016565   Gene: ENSTGUG00000016219   Transcript: ENSTGUT00000016901
Sequence length 302
Comment pep:novel chromosome:taeGut3.2.4:Un:162366600:162372575:1 gene:ENSTGUG00000016219 transcript:ENSTGUT00000016901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDTYFYSRGVAPEVSFKSYMKLNTSAGNIDLYKKLYTSGSCASGKVVSLRCIVLGVGWER
GQGIQIVGGSGAVLGQWPWQVSLHVQGTHVCGGSIITPRWLVTAAHCVEGRLSDPHSWRV
YAGILNQDEMLFRSGYKVQQIISHPDYDTDSKDNDVALMKLETPLSFTETVRPVCLPNPG
MMFQPNQQCWISGWGAEHQGGKTSNSLNYVAVPLIEHSRCNAVYIYNGMILPTMICAGDL
AGGIDSCQGDSGGPLVTLHHSVWWLVGDTSWGTGCATPNKPGVYGNMTVFTDWIYKNMQV
KY
Download sequence
Identical sequences H1A104
ENSTGUP00000016565 59729.ENSTGUP00000016565 ENSTGUP00000016565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]