SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016585 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016585
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.83e-41
Family beta-glycanases 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016585   Gene: ENSTGUG00000016265   Transcript: ENSTGUT00000016922
Sequence length 192
Comment pep:novel chromosome:taeGut3.2.4:Un:110626650:110627403:-1 gene:ENSTGUG00000016265 transcript:ENSTGUT00000016922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPILQAAQAVAKRPLSLYASPWTSPVWMKTNGAMTGRGTLKGSPGDKYHRAWAKYFIRFL
DEYAKHNLTFWAVTAGNEPTAGEIIFYPFQCLGFSPEHQRDFIAQDLGPALANSSHRHVQ
LIILDDQRVMLPYWAEVVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPDYFLL
STEASAGSYFWE
Download sequence
Identical sequences H1A124
59729.ENSTGUP00000016585 ENSTGUP00000016585 ENSTGUP00000016585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]