SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016646 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016646
Domain Number 1 Region: 90-211
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-33
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 201-305
Classification Level Classification E-value
Superfamily Cadherin-like 1e-24
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 1-95
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-17
Family Cadherin 0.015
Further Details:      
 
Domain Number 4 Region: 301-350
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-16
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016646   Gene: ENSTGUG00000016346   Transcript: ENSTGUT00000016987
Sequence length 351
Comment pep:novel chromosome:taeGut3.2.4:Un:110969747:110977981:1 gene:ENSTGUG00000016346 transcript:ENSTGUT00000016987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPETSEPGSCFPMEAAQDLDIGSNTVQEYSISPENEYFRVSYGSRITGKKSLELVLEKPL
DREEHAEMGFSVIALDGGSPPRSGTTHVKIFILDVNDNAPIFTQEEYIAQVLENMPEGSV
VLTVLATDQDAGVNGDITYQLSQAVGKSDSAFLIDPITGAIKLTKPLDFEAAESHEMSVR
ATDGGGLSAICKVLVEVVDVNDNAPELVVSSFSSPIPENTVPGTVVALFSVRDRDSGANG
KISCALEDQLSFSLRPAYKNYYELLVLAKALDREEAAFHELVLRAMDGGDPARTGTARIR
VTVLDANDNAPVFSQAEYTVRVPEDVPVGSVLVTVTATDADEGQNGQVKYS
Download sequence
Identical sequences H1A185
59729.ENSTGUP00000016646 ENSTGUP00000016646 ENSTGUP00000016646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]