SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016679 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016679
Domain Number 1 Region: 41-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000474
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 3-80,122-162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000722
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016679   Gene: ENSTGUG00000016379   Transcript: ENSTGUT00000017022
Sequence length 163
Comment pep:novel chromosome:taeGut3.2.4:Un:48191828:48194406:1 gene:ENSTGUG00000016379 transcript:ENSTGUT00000017022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISNQCSPLPCHKDGYKDCIDGQAKYTCVCKAGWRGENCEEDINECEDFNGGCSQRCSNFP
GSFRCLCEDGYFMHSNKRDCGGRETSGEPPSLPAQCLLTRGREGKERGSNYSSLLELHKA
CFDIDECAENICAQLCVNSPGSYSCYCDGKKGFKLSKDMKNCE
Download sequence
Identical sequences H1A1B7
ENSTGUP00000016679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]