SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016700 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016700
Domain Number 1 Region: 65-96
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000241
Family Type II chitinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016700   Gene: ENSTGUG00000016397   Transcript: ENSTGUT00000017044
Sequence length 116
Comment pep:novel chromosome:taeGut3.2.4:Un:111490961:111492574:1 gene:ENSTGUG00000016397 transcript:ENSTGUT00000017044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDHVCSLPKVPFRGAPCSDAAGSQVPYAAIMKQVNSSLSGLLWDEVQKAPFYEYKDSVGQ
FHQVWFDDPQSISLKAAYVKSRGLRGIGMWNGNSLDYSREAAAEQQTQAMWQALTP
Download sequence
Identical sequences H1A1D8
ENSTGUP00000016700 ENSTGUP00000016700 59729.ENSTGUP00000016700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]