SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016711 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016711
Domain Number 1 Region: 140-237
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0047
Further Details:      
 
Domain Number 2 Region: 6-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000271
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016711   Gene: ENSTGUG00000016403   Transcript: ENSTGUT00000017055
Sequence length 329
Comment pep:novel chromosome:taeGut3.2.4:Un:111504147:111508136:1 gene:ENSTGUG00000016403 transcript:ENSTGUT00000017055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGLYFPRKEYLENVYIDEPAGMPLLRIHALRDSHEEVAHFHLCQHLIVPRARPQENNW
FQIREKTGLLYLSRSLDREDFNMLSVGSWMPLSKVMLYVSVSHPFQEKDCDSATRTTVFL
SLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLPSVHHLCQNLSISYKLL
AAEGVPFRYNENTTSVRVTQRLDREERERYELIAKCTVREGFREMQVEVPFLVNVLDEDD
SPPFLPNGTDTADAVVEFNRKEGAVLSTLTVYDADTTPIYPLESSRKKYTGTIITDDPWI
SETFRVEHIFDEIHFSPNGSQVRGTRHEY
Download sequence
Identical sequences H1A1E9
ENSTGUP00000016711 59729.ENSTGUP00000016711 ENSTGUP00000016711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]