SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016733 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016733
Domain Number 1 Region: 760-866
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 653-759
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-23
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 445-561
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 558-665
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 89-205
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 6 Region: 1079-1197
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 862-976
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 981-1091
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000314
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 337-457
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000115
Family Cadherin 0.0065
Further Details:      
 
Domain Number 10 Region: 250-335
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000257
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016733   Gene: ENSTGUG00000016392   Transcript: ENSTGUT00000017078
Sequence length 1855
Comment pep:known_by_projection chromosome:taeGut3.2.4:6_random:627182:838355:-1 gene:ENSTGUG00000016392 transcript:ENSTGUT00000017078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTILVDNMLIKGTAGGPDPTIELSLKDNVDYWVILDPIKQTLYLNSTGRVLDRDPPVSIQ
SIVVQVQCVNKKVGTIINHEVRIVVRDRNDNSPQFQQQRYYVAVNELTPVGTTIFTGFSG
NNGAIDIDDGPNGQIEYVIQYNPNDKTSNRTFDIPLTLSGAVVLRERLNYEEKTRYFVIV
QANDRAQNLNERRTSTTTLTVDVLDGDDLGPMFLPCVLVNNTRDCRPLTYQASLPELTDP
AHVNPISVSPPIQAIDQDRNIQPPSERPGILYSILVGTPEDYPQYFHMNLTTAELTLLKP
INRDLHQKFDLVIKAEQDNGHPLPAFANLHIEILDENNQKPYFTRSTYEGFILESSPVGT
TISDNQNLTSPLQLVVLDNDVEETKDPQLHLFLNDYTTFFTVTQSGITRYLTLLQPVDRE
VQQLYTFSMTASDGVQESVPVTVNILVIDANDNSPTFSNISYSVKIYTDMKPGESVIKLT
AVDADEGANGQIVYEILAGDQGDFTINKHTGLITIAPGVLLAVGRSYALTVRASDSAPPA
QRRSSITTVYIEVLPPNNQSPPRFPQLMYSLEVSEAMRIGAVLLNLQAFDREGDPIKYLI
QNGDPQQVFNLSQSSGLLALGKPLDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVND
NGPVFDMFLPKNLSVQEEEANAFVGQVRATDADAGVNGQVHYSLANFNNLFRITSNGSIY
TAVKLNREVRDYYELIVEATDGAVDPRRSTLTLAIKVLDIDDNSPVFTNASYTVCVPENL
PPGTVFLQLEAKDVDLGADVNYRIRTEEARQYFALNRHTGELSLRKSLDYESFSDTEATF
TFLVEAFDSKGTMPPGLATVTVRVKDMNDYSPEFSQKLYRGMVAPDAVKGTVITTVSAED
RDPPGTPASLVRYKVDVVQFPYSASIFDVEENSGRVVTRVNLNEEPSTVFKLVVIAYDDG
DPVKFNTTTVEIAVLQPSVIPRFTQDEYRPPPVSESAPKGTVVTVVTAAALNQTVVYSIV
SGNEEXXWPLTTESGVISVKKPLDYERVQSYELRVQADLQVVRSNVRVPSKSNTAKVFIE
VKDENDHAPVFTKKMYIGGVSEDARMFSSVLKVKADDKDTGNYSAMQYRLIIPPIKDGKE
GFVIEAYTGLIKTAMLFKNMRRSYFKFQVIATDDYGKGLSSKAEVLVSVVNQLDMQVIVS
NVPPTLVEQNKDQLIGILERYVQDQIPGATVVVESIGARRFGDGYSEEDYTKSDLMVYAI
DPQTNRAIMRNELFKFLDGKLLDINKEFQPYLGQGGRILEIRTPDVVANVKKQAQAVGYT
EGALLALAVIIILCCMPAILIVMVSYRQFQRRQAECAKTARIQMALPAGKPAGAAANNLY
EELGDSTILFLLYHFQQSRGKKSVLEEGDRQRVISSFASRAIEAHKQSSINGSLNNNLPK
SSSNITFLSDENPLTTQNPLYVEGLPQSPAASGFLRKRNDTLDTLSPSRLAWREASFGSS
HRAWTVPTHLTRRHMSGSLGRPVIMDPIQWQQQRLTAKEEGAENPDSSDDVSSPLFQKIS
GPKLTVKEKARQFEALQEMKQVRSPEVKSTRSPTHSTGVQEGESASEQSPKSVVASPHLR
SSPLSSPTPCAEGVEAEATVVPAVIVTHHDDHQEHSPPPTHKPTPPSSRIKKPLCQSFLA
PQTKENVESIPDPPKIPPPPPPQLSPPLPPPPPSPPLLPPHPPPPPAVSLPSSSSSSPSP
LSTQLLSPAKHSKSPAKHPAVPTPAAVPELPPRRELKGILKNIQNLAAIEKSVANMYSQI
DKNHLLPKHVPKLKPAPTPELPTPEAAAEHNQQNGNLSCVVEELEKRFPSQSTAL
Download sequence
Identical sequences H1A1H1
ENSTGUP00000016733 ENSTGUP00000016733 59729.ENSTGUP00000016733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]