SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016735 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016735
Domain Number 1 Region: 3-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-37
Family Pentraxin (pentaxin) 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016735   Gene: ENSTGUG00000016438   Transcript: ENSTGUT00000017081
Sequence length 202
Comment pep:novel chromosome:taeGut3.2.4:Un:135324028:135324633:1 gene:ENSTGUG00000016438 transcript:ENSTGUT00000017081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLYRKVFVFRKDPSDAFVALRARLQQPLHNFTVCLRSYTDLTRPHSLFSYATKAQDNEIL
LFKPKPEEYRFYVGGKFVTFRVPEGRREWEHVCASWESATGIAEFWLNGKPWPRKGLQRG
YTVGATASILLGQEQDSFGGGFDLYNSFSGELTDVYLWDAGLSPEKMRAAFLSLRLPPAL
LAWNGLSYEVKGDVVVKPRLRE
Download sequence
Identical sequences H1A1H3
ENSTGUP00000016735 59729.ENSTGUP00000016735 ENSTGUP00000016735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]