SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016762 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000016762
Domain Number - Region: 15-107
Classification Level Classification E-value
Superfamily MIR domain 0.034
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016762   Gene: ENSTGUG00000016465   Transcript: ENSTGUT00000017110
Sequence length 123
Comment pep:novel chromosome:taeGut3.2.4:Un:81128673:81130594:1 gene:ENSTGUG00000016465 transcript:ENSTGUT00000017110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLASDHKTFRDFAKKSRLQKVFLTAELSYLTFWQAKSLDPQLRLEHEGFPVPAETKIIIT
HCYTNRNLAVPRTFCVWSHFGREFEVICHNYLDSRRVEEDKNHWEIITGNPGPEDGTMLE
RPK
Download sequence
Identical sequences H1A1K0
ENSTGUP00000016762 59729.ENSTGUP00000016762 ENSTGUP00000016762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]