SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016773 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016773
Domain Number 1 Region: 52-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016773
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016773   Gene: ENSTGUG00000016471   Transcript: ENSTGUT00000017121
Sequence length 102
Comment pep:novel chromosome:taeGut3.2.4:1_random:1188985:1190869:1 gene:ENSTGUG00000016471 transcript:ENSTGUT00000017121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLDECATSPCKDHQYCLNTDGSFSCKACDASCVGCTGEGPGKCKTCASGYVKEDEACTDV
DECNLPEKVCMKENQDCVNTSGSYKCVCSEGFEDKDGTCVQT
Download sequence
Identical sequences H1A1L1
ENSTGUP00000016773 59729.ENSTGUP00000016773 ENSTGUP00000016773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]