SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016792 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016792
Domain Number 1 Region: 215-333
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-36
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 40-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-23
Family First domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 181-216
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000284
Family Second domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016792   Gene: ENSTGUG00000016482   Transcript: ENSTGUT00000017141
Sequence length 334
Comment pep:known_by_projection chromosome:taeGut3.2.4:20_random:66455:69732:1 gene:ENSTGUG00000016482 transcript:ENSTGUT00000017141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGTDMEDKDYSETDGLSDKTTPSKTQKSPQKTTKKVKSALCRVTLLDASEYECEVEKHAR
GQVLFDMVCEHLNLLEKDYFGLTFCDSDSQKNWLDPSKEIKKQIRSKFLGRVHPPQPGVS
HVAPGWLSMAGRCCSFSCLLPTSSLTRERRGDKGLHLGQEDMDGRERGFYWGTELVAPAI
TRELRSTHELHKTYRGMTPGEAEIHFLENDKKLSMYGVDLHHAKDSEGIDIMLGVCANGL
LIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVC
IEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQA
Download sequence
Identical sequences H1A1N0
ENSTGUP00000016792 ENSTGUP00000016792 59729.ENSTGUP00000016792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]