SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016874 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000016874
Domain Number - Region: 19-65
Classification Level Classification E-value
Superfamily Cadherin-like 0.0298
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016874   Gene: ENSTGUG00000016578   Transcript: ENSTGUT00000017225
Sequence length 76
Comment pep:novel chromosome:taeGut3.2.4:Un:164940923:164941974:1 gene:ENSTGUG00000016578 transcript:ENSTGUT00000017225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGQVLRCDAIVDLIHGIQVVSTMRELYLEDSPLELKIHALDSEGNTFSTLAGLVFDWTLV
KDPEPDGFSDSHNTLR
Download sequence
Identical sequences H1A1W2
59729.ENSTGUP00000016874 ENSTGUP00000016874 ENSTGUP00000016874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]