SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016883 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016883
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-21
Family Laminin G-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016883   Gene: ENSTGUG00000016588   Transcript: ENSTGUT00000017234
Sequence length 116
Comment pep:known_by_projection chromosome:taeGut3.2.4:21_random:108571:109244:1 gene:ENSTGUG00000016588 transcript:ENSTGUT00000017234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVVPYFGQSPRSFLPLPTIKDAYKRFEILITFRPDAADGLLLYNGQRKNSGADFISFGL
VGGRPEFRFDAGSGMATIRHPTALRLGEYHTVRLLRNLTWGSLGLDGHPAVNGTSQ
Download sequence
Identical sequences H1A1X1
59729.ENSTGUP00000016883 ENSTGUP00000016883 ENSTGUP00000016883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]