SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016897 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016897
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000526
Family Type II chitinase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016897   Gene: ENSTGUG00000016603   Transcript: ENSTGUT00000017250
Sequence length 146
Comment pep:novel chromosome:taeGut3.2.4:Un:165218477:165221098:1 gene:ENSTGUG00000016603 transcript:ENSTGUT00000017250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSESGVPQLVQPMIWDYAADIDVVGKVQLIEKYRRCGFSKVWFASAFKGATGVNQSLTLI
GHHLRNQLEWLQVASRSPADVLEGIALTGWQRYDHFSVLCELLPVGIPSLAVCLQALKNG
GYSEKIKENVENLLGMPNLEIDTFTR
Download sequence
Identical sequences H1A1Y5
ENSTGUP00000016897 59729.ENSTGUP00000016897 ENSTGUP00000016897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]