SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016903 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016903
Domain Number 1 Region: 13-180
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-42
Family Eukaryotic proteases 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016903   Gene: ENSTGUG00000016605   Transcript: ENSTGUT00000017257
Sequence length 181
Comment pep:novel chromosome:taeGut3.2.4:Un:113745103:113747129:1 gene:ENSTGUG00000016605 transcript:ENSTGUT00000017257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEKWTATFGALLKPPSLKRSVKKIIIHENYLYPEHDYDIALVQLSKRVEFTSSIHHVCLP
EPSQTFPYNIYAVITGWGALTNDGDKPNVCNRKMPQTSDSSFRNSRDSSQKAALAIMLVS
FSYRIDPPGDSGGPLVTPDSRLMWYLVGIVSWGDECGKPNKPGVYTRVTYFRDWITTKTG
I
Download sequence
Identical sequences H1A1Z1
59729.ENSTGUP00000016903 ENSTGUP00000016903 ENSTGUP00000016903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]