SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016927 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016927
Domain Number 1 Region: 33-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-107
Family Thrombospondin C-terminal domain 0.00000000152
Further Details:      
 
Domain Number 2 Region: 1-31
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000471
Family TSP type-3 repeat 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016927   Gene: ENSTGUG00000016632   Transcript: ENSTGUT00000017283
Sequence length 248
Comment pep:novel chromosome:taeGut3.2.4:Un:113861155:113862696:-1 gene:ENSTGUG00000016632 transcript:ENSTGUT00000017283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGRGDACKDDFDQDSVPDIDDICPENVEISETDFRKFQMIPLDPKGTSQNDPNWVVRHQ
GKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQ
ITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGW
KDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSD
LKYECRGK
Download sequence
Identical sequences H1A215
ENSTGUP00000016927 ENSTGUP00000016927 59729.ENSTGUP00000016927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]