SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016970 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016970
Domain Number 1 Region: 66-421
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.97e-88
Family beta-glycanases 0.000000000345
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.52e-17
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000016970
Domain Number - Region: 420-456
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0863
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016970   Gene: ENSTGUG00000016660   Transcript: ENSTGUT00000017328
Sequence length 456
Comment pep:novel chromosome:taeGut3.2.4:Un:81581111:81583155:1 gene:ENSTGUG00000016660 transcript:ENSTGUT00000017328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVCVCNATFCDTLDPLVLPASGYFVKYESSKAGKRLERSEGKFQRRLCPSDVVLTLDTTQ
RFQKVKGFGGSITDAAAINILSLPEGAQDHLLRSYFSEEGLEYNLIRLPMASCDFSLHAY
TYDDVPYDYELAHFSLRDEDTKLKASAGREQASAMSKRPLSLYASPWTSPTWLKTSESYV
GKGTLKGQAGDKYHKTWANYFVRFLDEYAKHNVTFWAVTAENEPTAGLINNYPFQCLGFT
AEQQRDFIARDLGPALANSSHRHVQLIILDDNRLHLPHWARVVLEDEGAARYVHGIGIHW
YLDFIGPIQDTVLPTHELFPDYFILATEACIGAHFWERDVILGCWERGNQYSHSILTNLN
HYVAHAQWTDWNLALDLEGGPNWVKNYVDSPIIVDSSEGIFYKQPMFYHMGHFSKFIPEG
SQRVGLVASRESKKTALEYTAFLRPDGAVVVVVLNR
Download sequence
Identical sequences H1A258
59729.ENSTGUP00000016970 ENSTGUP00000016970 ENSTGUP00000016970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]