SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017049 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017049
Domain Number 1 Region: 199-236
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000123
Family CPH domain 0.0021
Further Details:      
 
Domain Number 2 Region: 95-151
Classification Level Classification E-value
Superfamily UBA-like 0.00000277
Family UBA domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017049   Gene: ENSTGUG00000016759   Transcript: ENSTGUT00000017414
Sequence length 236
Comment pep:novel chromosome:taeGut3.2.4:Un:23407951:23410480:1 gene:ENSTGUG00000016759 transcript:ENSTGUT00000017414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGAVASPDIGDMSPEGPQPPMILLQQLLSAATQPSPVKAIFDKQELEAAALAVCQYLAV
ESTHPSTPLFEDCSSSEATTPITVQHIRPTKVKKRKQSPIPPLPIVVQLMEMGFPRKNIE
FALKSLSGTSGSASGLPGVEALVGWLLDHPDVQITDLSDADTISDEYSDEEIAEEVEEAE
AACPSSGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRTYEEVCEGDV
Download sequence
Identical sequences H1A2D7
59729.ENSTGUP00000017049 ENSTGUP00000017049 ENSTGUP00000017049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]