SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017060 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017060
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-50
Family SPRY domain 0.0000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017060   Gene: ENSTGUG00000016773   Transcript: ENSTGUT00000017427
Sequence length 186
Comment pep:novel chromosome:taeGut3.2.4:Un:166239454:166240011:1 gene:ENSTGUG00000016773 transcript:ENSTGUT00000017427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVILDADTAHPRLEISADGRRVKDTGVIRFLFRNEKRFDSHLFVLAKEGYTSGKHYWEVN
VGTRRNWALGIACESVTRKGTLTLCPENGFWVIACVDGQDYLACTNPWTCLTVTGCLSKI
GIFLNIPAKQVSFYDVFRAVALYTFSIAEGSSQEGKFLPFFSTGLAASEPDTEPLEILPF
SDDDDE
Download sequence
Identical sequences H1A2E8
ENSTGUP00000017060 59729.ENSTGUP00000017060 ENSTGUP00000017060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]