SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017085 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017085
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 58-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 183-248
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 128-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017085   Gene: ENSTGUG00000016789   Transcript: ENSTGUT00000017456
Sequence length 281
Comment pep:novel chromosome:taeGut3.2.4:Un:23829477:23832669:1 gene:ENSTGUG00000016789 transcript:ENSTGUT00000017456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTCPALEMPIHGAVNCSHPSVQLTWGTTCEFTCEEGFTLTGPATLQCGSSGAWDRQQPTC
AAVRCEAVPRPAEGSVSCDHAPAELTSGSRCDFQCQEGYVLEGSPSTECTAQGQWSEPVP
KCKKTVTCPALEMPIHGAVNCSHPSVQLTWGTTCEFTCEEGFTLTGPATLQCGSLGAWDR
QQPTCAVIQCEPLSSPEKGSMDCSHRAGMFTYNTSCHFSCLEGWSLNGSRVLQCSHSGNW
SASLPTCEASDQASYISVGIAATSASLLSSASFLLWLCKAL
Download sequence
Identical sequences H1A2H3
59729.ENSTGUP00000017085 ENSTGUP00000017085 ENSTGUP00000017085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]