SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017132 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017132
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000617
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017132   Gene: ENSTGUG00000016846   Transcript: ENSTGUT00000017507
Sequence length 160
Comment pep:novel chromosome:taeGut3.2.4:Un:82234278:82236161:-1 gene:ENSTGUG00000016846 transcript:ENSTGUT00000017507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECAIGTHNCSAAETCYNIQGSFRCLSFECPSNYRKVSDMRCERISCFNYLECQNTPV
RITYYQLNFQTNIVVPAHIFRIGPSPAYAGDNIVLTITKGNEEGFFSTRRLNSYTGIVYL
QRQVKEPKDFLLDVEMKLWRQGTYTTFLAKIYIFITAHAY
Download sequence
Identical sequences H1A2M0
59729.ENSTGUP00000017132 ENSTGUP00000017132 ENSTGUP00000017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]