SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017145 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017145
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.12e-32
Family Laminin G-like module 0.0000434
Further Details:      
 
Domain Number 2 Region: 148-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-25
Family Laminin G-like module 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017145   Gene: ENSTGUG00000016851   Transcript: ENSTGUT00000017522
Sequence length 345
Comment pep:novel chromosome:taeGut3.2.4:Un:138886764:138892976:1 gene:ENSTGUG00000016851 transcript:ENSTGUT00000017522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFTAEFDFRTYDAEGLILYAESLDNSAWILLALRDGKIEIQFKNEFGTKVTSGGKAINDG
LWHIVSVEELEHSISVKIAKEAVMSINSPGTLFKQSQGFLETKVYIAGLPRRVGGALVKQ
INPRLDGCIRAWNLMNQGHSGVNEVIQEKESKHCFVEVERGSFYPGTGMAAFQINYNNLD
SAEDWLINVTLTIRPSTDTGVMFALVSNETVPLALSIVGSNSSDSQKITVTIGNIIIAQL
ESKKLCTPKKVQVGLLVTKQELELAVDSHTDRSNSEQLSTLHQAMMANVVTYLGGLPDVP
LGATPVTAFYNGCMEVKVNSRQLDLDEAISKHNDIRSHSCPRIMQ
Download sequence
Identical sequences H1A2N3
ENSTGUP00000017145 ENSTGUP00000017145 59729.ENSTGUP00000017145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]