SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017169 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017169
Domain Number 1 Region: 72-315
Classification Level Classification E-value
Superfamily SET domain 7.59e-56
Family Histone lysine methyltransferases 0.00021
Further Details:      
 
Domain Number 2 Region: 3-38
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000403
Family Chromo domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017169   Gene: ENSTGUG00000016885   Transcript: ENSTGUT00000017550
Sequence length 360
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:53252247:53254496:1 gene:ENSTGUG00000016885 transcript:ENSTGUT00000017550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEFYLVKWRGYPSSANTWEPRRNLRCRGLLQQLHADLARAPGGPVRPGPRGLPARAVSY
LAQKAEQRRALRRWERHLNRTRSHRGRIAVENEVDLHGPPRDFVYVNEYKVGAGVALTPV
AAGCECRDCLAEATLAGGCCPGASRNRFAYNEAGQVRIRAGLPIYECNSRCRCGAECPNR
VVQRGIRYNLCIFRTGDGRGWGVRTLQRIRKNSFVMEYVGEVSVTDENAPGASHVRFVAK
APPIFNMKLMGAVSWIRWGFLPTGGRFTWAQCDPNLQVYNVFIENLDQRLPRIALFATRP
IRAGEELTFDYNMHVDPVDAESTRMDSNFGLVGGSLGGSPRARGRIECKCGAASCRKYLF
Download sequence
Identical sequences H1A2Q7
59729.ENSTGUP00000017169 ENSTGUP00000017169 ENSTGUP00000017169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]