SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017245 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017245
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.07e-26
Family Interleukin 17F, IL-17F 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017245   Gene: ENSTGUG00000016961   Transcript: ENSTGUT00000017628
Sequence length 100
Comment pep:novel chromosome:taeGut3.2.4:Un:83329003:83329302:1 gene:ENSTGUG00000016961 transcript:ENSTGUT00000017628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RISYDPTRYPKYIPEAYCLCKGCLMGIFGEESLHFRSTPVFMPTVILRRTPACAGGRYVY
TEDYITIPVGCTCVPEQEKEAESANSSIDKQEVKLLVGQN
Download sequence
Identical sequences H1A2Y3
59729.ENSTGUP00000017245 ENSTGUP00000017245 ENSTGUP00000017245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]